The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Putative ABC transporter (ATP-binding protein) from Pyrococcus furiosus Pfu-867808-001. To be Published
    Site SECSG
    PDB Id 1sgw Target Id Pfu-867808-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9310, Molecular Weight 23150.94 Da.
    Residues 206 Isoelectric Point 8.41
    Sequence mkleirdlsvgydkpvleritmtiekgnvvnfhgpngigkttllktistylkplkgeiiyngvpitkvk gkifflpeeiivprkisvedylkavaslygvkvnkneimdalesvevldlkkklgelsqgtirrvqlas tllvnaeiyvlddpvvaidedskhkvlksileilkekgiviissreelsycdvnenlhkystkidkkd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.22299
    Matthews' coefficent 2.29 Rfactor 0.19538
    Waters 96 Solvent Content 46.38

    Ligand Information
    Metals CL (CHLORIDE) x 2;NA (SODIUM) x 1


    Google Scholar output for 1sgw

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch