.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sf0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Backbone solution structures of proteins using residual dipolar couplings: Application to a novel structural genomics target. J.STRUCT.FUNCT.GENOM. 5 241-254 2005
    Site SECSG
    PDB Id 1sf0 Target Id Pfu-1016054-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9369, Molecular Weight 7685.62 Da.
    Residues 69 Isoelectric Point 5.40
    Sequence mkmikvkvigrniekeiewregmkvrdilravgfntesaiakvngkvvleddevkdgdfvevipvvsgg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1sf0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch