.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sen

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Endoplasmic reticulum protein Rp19. To be Published
    Site SECSG
    PDB Id 1sen Target Id O95881
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS9352, Molecular Weight 19204.76 Da.
    Residues 172 Isoelectric Point 5.25
    Sequence metrprlgatcllgfsflllvissdghnglgkgfgdhihwrtledgkkeaaasglplmviihkswcgac kalkpkfaesteiselshnfvmvnledeeepkdedfspdggyiprilfldpsgkvhpeiinengnpsyk yfyvsaeqvvqgmkeaqerltgdafrkkhledel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.20 Rfree 0.1835
    Matthews' coefficent 2.01 Rfactor 0.1616
    Waters 97 Solvent Content 38.74

    Ligand Information
    Ligands
    Metals PT (PLATINUM) x 2;CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 1sen

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch