.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s36

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Ca2+-discharged photoprotein: implications for mechanisms of the calcium trigger and bioluminescence. J.Biol.Chem. 279 33647-33652 2004
    Site SECSG
    PDB Id 1s36 Target Id Oob-Ca_W92F_Obelin
    Molecular Characteristics
    Source Obelia longissima
    Alias Ids TPS9357, Molecular Weight 22185.70 Da.
    Residues 195 Isoelectric Point 4.89
    Sequence msskyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhqvcve affrgcgmeygkeiafpqfldgfkqlatselkkwarneptlirewgdavfdifdkdgsgtitldewkay gkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpeadglygngvp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.96 Rfree 0.25922
    Matthews' coefficent 2.31 Rfactor 0.22278
    Waters 145 Solvent Content 46.86

    Ligand Information
    Ligands CEI (N-[3-BENZYL-5-(4-HYDROXYPHENYL)PYRAZIN-2-YL]-2-(4-) x 1;GOL (GLYCEROL) x 1
    Metals NA (SODIUM) x 1;CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 1s36

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch