The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of two UBC (E2) enzymes of the ubiquitin-conjugating system in Caenorhabditis elegans. To be Published
    Site SECSG
    PDB Id 1pzv Target Id F58A4.10
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9278, Molecular Weight 18937.65 Da.
    Residues 164 Isoelectric Point 5.06
    Sequence meqsslllkkqladmrrvpvdgfsaglvddndiykwevlvigppdtlyeggffkaildfprdypqkppk mkfiseiwhpnidkegnvcisilhdpgddkwgyerpeerwlpvhtvetillsvismltdpnfespanvd aakmqrenyaefkkkvaqcvrrsqee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.52 Rfree 0.289
    Matthews' coefficent 2.30 Rfactor 0.241
    Waters 41 Solvent Content 46.42

    Ligand Information


    Google Scholar output for 1pzv

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch