The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of Caenorhabditis elegans: crystal structure of the tropomodulin C-terminal domain. Proteins 56 384-386 2004
    Site SECSG
    PDB Id 1pgv Target Id C06A5.7
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9290, Molecular Weight 45533.40 Da.
    Residues 401 Isoelectric Point 4.67
    Sequence msnmeppppmfprsriyhsyyseektfsapsansqqgtqlpskvynkglkdndiegllsslsideledl nndfdpdnsmlppsqrcrdqtdkeptgpykrdnllkfledkaktekdwedvcpytpgqkrgkvydsdsg rnseepengkmempieidldddeeelecalvtapekdlvdlagilgmhnvlnqpqyynalkgktqdest gttfngimqsyvprivpdepdndtdvescinrlreddtdlkevninnmkrvskerirslieaacnskhi ekfslantaisdsearglielietspslrvlnvesnfltpellarllrstlvtqsivefkadnqrqsvl gnqvemdmmmaieenesllrvgisfasmearhrvsealernyervrlrrlgkdpnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.234
    Matthews' coefficent 2.08 Rfactor 0.209
    Waters 131 Solvent Content 40.50

    Ligand Information


    Google Scholar output for 1pgv

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch