.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nxc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of mouse Golgi alpha-mannosidase IA reveals the molecular basis for substrate specificity among class 1 (family 47 glycosylhydrolase) alpha1,2-mannosidases. J.Biol.Chem. 279 29774-29786 2004
    Site SECSG
    PDB Id 1nxc Target Id Mum-ManA1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS9358, Molecular Weight 73271.90 Da.
    Residues 655 Isoelectric Point 6.34
    Sequence mpvggllplfsspgggglgsglggglgggrkgsgpaafrltekfvlllvfsafitlcfgaifflpdssk llsgvlfhsnpalqppaehkpglgaraedaaegrvrhreegapgdpgaglednlarirenheralreak etlqklpeeiqrdillekekvaqdqlrdkdlfrglpkvdflppvgvenrepadatirekrakikemmth awnnykryawglnelkpiskeghssslfgnikgativdaldtlfimgmktefqeakswikkyldfnvna evsvfevnirfvggllsayylsgeeifrkkavelgvkllpafhtpsgipwallnmksgigrnwpwasgg ssilaefgtlhlefmhlshlsgdpvfaekvmkirtvlnkldkpeglypnylnpssgqwgqhhvsvgglg dsfyeyllkawlmsdktdleakkmyfdavqaiethlirkssggltyiaewkggllehkmghltcfaggm falgadgapearaqhylelgaeiartchesynrtyvklgpeafrfdggveaiatrqnekyyilrpevie tymymwrlthdpkyrtwaweavealeshcrvnggysglrdvyiaresyddvqqsfflaetlkylylifs dddllplehwifnteahpfpilreqkkeidgkek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.51 Rfree 0.1897
    Matthews' coefficent 2.25 Rfactor 0.17079
    Waters 322 Solvent Content 44.81

    Ligand Information
    Ligands NAG-NAG-BMA-MAN-MAN-MAN-MAN-MAN (N-ACETYL-D-GLUCOSAMINE) x 1
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 1nxc

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch