.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mo0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of Caenorhabditis elegans: triosephosphate isomerase. Proteins 51 484-486 2003
    Site SECSG
    PDB Id 1mo0 Target Id AAA79846
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9289, Molecular Weight 26572.99 Da.
    Residues 247 Isoelectric Point 6.23
    Sequence mtrkffvggnwkmngdyasvdgivtflnasadnssvdvvvappapylayaksklkagvlvaaqncykvp kgaftgeispamikdlglewvilghserrhvfgesdaliaektvhaleagikvvfcigekleereaght kdvnfrqlqaivdkgvsweniviayepvwaigtgktasgeqaqevhewiraflkekvspavadatriiy ggsvtadnaaelgkkpdidgflvggaslkpdfvkiinars
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.213
    Matthews' coefficent 2.06 Rfactor 0.183
    Waters 461 Solvent Content 38.09

    Ligand Information
    Ligands ACT (ACETATE) x 2;SO4 (SULFATE) x 5
    Metals

    Jmol

     
    Google Scholar output for 1mo0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch