.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mjf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title PUTATIVE SPERMIDINE SYNTHETASE FROM PYROCOCCUS FURIOSUS PFU-132382. to be published
    Site SECSG
    PDB Id 1mjf Target Id Pfu-132382-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9367, Molecular Weight 32332.74 Da.
    Residues 281 Isoelectric Point 5.78
    Sequence merafiewyprgygvafkikkkiyeklskyqkievyetegfgrllaldgtvqlvtlgersyheplvhpa mlahpkpkrvlvigggdggtvrevlqhdvdevimveidedvimvskdlikidnglleamlngkhekakl tigdgfefiknnrgfdviiadstdpvgpakvlfseefyryvydalnnpgiyvtqagsvylftdelisay kemkkvfdrvyyysfpvigyaspwaflvgvkgdidftkidrerakklqleyydplmhetlfqmpkyire tlqrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.24156
    Matthews' coefficent 2.01 Rfactor 0.20482
    Waters 201 Solvent Content 38.95

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1mjf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch