.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lpl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Cytoskeleton-associated Protein Glycine-rich (CAP-Gly) Domain. J.Biol.Chem. 277 48596-48601 2002
    Site SECSG
    PDB Id 1lpl Target Id F53F4.3
    Related PDB Ids 1t0y 1tov 
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9281, Molecular Weight 25439.30 Da.
    Residues 229 Isoelectric Point 4.70
    Sequence mtevydleittnatdfpmekkypagmslndlkkklelvvgttvdsmriqlfdgddqlkgeltdgakslk dlgvrdgyrihavdvtggnedfkdesmvekyemsddtygkrtdsvrawkkkmqeeqgsaapmenesdkl neeaaknimvgnrcevtvgaqmarrgevayvgatkfkegvwvgvkydepvgkndgsvagvryfdcdpky ggfvrpvdvkvgdfpelsidei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.77 Rfree 0.297
    Matthews' coefficent 2.92 Rfactor 0.22
    Waters 86 Solvent Content 57.91

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1lpl

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch