The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure determination of P. aeruginosa lectin-1 using single wavelength anomalous scattering data from native crystals (P028). AM.CRYST.ASSOC.,ABSTR.PAPERS (ANNUAL MEETING) 29 98 2002
    Site SECSG
    PDB Id 1l7l Target Id Pae-lectin1
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS9354, Molecular Weight 12761.57 Da.
    Residues 121 Isoelectric Point 5.04
    Sequence awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichdafcgalvmki gnsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.2002
    Matthews' coefficent 3.82 Rfactor 0.19225
    Waters 107 Solvent Content 67.76

    Ligand Information
    Metals CA (CALCIUM) x 1


    Google Scholar output for 1l7l

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch