The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Peptidoglycan recognition by pal, an outer membrane lipoprotein. Biochemistry 45 2122-2128 2006
    Site S2F
    PDB Id 2aiz Target Id HI0381
    Molecular Characteristics
    Alias Ids TPS14866, Molecular Weight 16107.02 Da.
    Residues 153 Isoelectric Point 6.09
    Sequence mnkfvksllvagsvaalaacsssnndaagngaaqtfggysvadlqqryntvyfgfdkyditgeyvqild ahaaylnatpaakvlvegntdergtpeynialgqrradavkgylagkgvdagklgtvsygeekpavlgh deaaysknrravlay
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2aiz

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch