The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of HI0004, a putative essential gene product from Haemophilus influenzae, and comparison with the X-ray structure of an Aquifex aeolicus homolog. Protein Sci. 14 424-430 2005
    Site S2F
    PDB Id 1xax Target Id HI0004
    Molecular Characteristics
    Alias Ids TPS14843, Molecular Weight 17354.54 Da.
    Residues 154 Isoelectric Point 4.18
    Sequence mgsvlvdlqiatenieglpteeqivqwatgavqpegnevemtvrivdeaeshelnltyrgkdrptnvls fpfecpdevelpllgdlvicrqvvereaseqekplmahwahmvvhgslhllgydhieddeaeemeslet qimqglgfddpylaek
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1xax

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch