The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the YgfY from Escherichia coli, a protein that may be involved in transcriptional regulation. Proteins 58 759-763 2005
    Site S2F
    PDB Id 1x6j Target Id ygfY
    Related PDB Ids 1x6i 
    Molecular Characteristics
    Alias Ids TPS14872, Molecular Weight 10546.56 Da.
    Residues 88 Isoelectric Point 5.29
    Sequence mdinnkarihwacrrgmreldisimpffeheydslsddekrifirllecddpdlfnwlmnhgkpadael emmvrliqtrnrergpvai
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.242
    Matthews' coefficent 1.75 Rfactor 0.188
    Waters 37 Solvent Content 33.50

    Ligand Information


    Google Scholar output for 1x6j

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch