.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r8g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title YbdK is a carboxylate-amine ligase with a gamma-glutamyl:Cysteine ligase activity: crystal structure and enzymatic assays. PROTEINS: STRUCT.,FUNCT.,GENET. 56 376-383 2004
    Site S2F
    PDB Id 1r8g Target Id ybdK
    Molecular Characteristics
    Source
    Alias Ids TPS14874, Molecular Weight 41686.18 Da.
    Residues 372 Isoelectric Point 5.73
    Sequence mplpdfhvsepftlgielemqvvnppgydlsqdssmlidavknkitagevkhditesmlelatdvcrdi nqaagqfsamqkvvlqaatdhhleicgggthpfqkwqrqevcdneryqrtlenfgyliqqatvfgqhvh vgcasgddaiyllhglsrfvphfialsaaspymqgtdtrfassrpnifsafpdngpmpwvsnwqqfeal frclsyttmidsikdlhwdirpsphfgtvevrvmdtpltlshavnmagliqatahwllterpfkhqekd yllykfnrfqacryglegvitdphtgdrrpltedtlrllekiapsahkigassaiealhrqvvsglnea qlmrdfvadggsliglvkkhceiwagd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.252
    Matthews' coefficent 2.06 Rfactor 0.189
    Waters 656 Solvent Content 40.39

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1r8g

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch