.
The Open Protein Structure Annotation Network
PDB Keyword
.

1oqf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of 2-methylisocitrate lyase in complex with product and with isocitrate inhibitor provide insight into lyase substrate specificity, catalysis and evolution. Biochemistry 44 2949-2962 2005
    Site S2F
    PDB Id 1oqf Target Id prpB
    Molecular Characteristics
    Source
    Alias Ids TPS14880, Molecular Weight 32132.83 Da.
    Residues 296 Isoelectric Point 5.44
    Sequence mslhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgistlddvlt dirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgakrcghrpnkaivskeemv driraavdaktdpdfvimartdalavegldaaieraqayveagaemlfpeaitelamyrqfadavqvpi lanitefgatplfttdelrsahvamalyplsaframnraaehvynvlrqegtqksvidtmqtrnelyes inyyqyeekldnlfarsqvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.93 Rfree 0.247
    Matthews' coefficent 2.59 Rfactor 0.191
    Waters 648 Solvent Content 52.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1oqf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch