.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nrk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the YgfZ protein from Escherichia coli suggests a folate-dependent regulatory role in one-carbon metabolism. J.Bacteriol. 186 7134-7140 2004
    Site S2F
    PDB Id 1nrk Target Id ygfZ
    Molecular Characteristics
    Source
    Alias Ids TPS14870, Molecular Weight 36092.16 Da.
    Residues 326 Isoelectric Point 5.18
    Sequence maftpfpprqptasarlpltlmtlddwalatitgadsekymqgqvtadvsqmaedqhllaahcdakgkm wsnlrlfrdgdgfawierrsvrepqltelkkyavfskvtiapddervllgvagfqaraalanlfselps kekqvvkegattllwfehpaerflivtdeatanmltdklrgeaelnnsqqwlalnieagfpvidaansg qfipqatnlqalggisfkkgcytgqemvarakfrgankralwllagsasrlpeagedlelkmgenwrrt gtvlaavkledgqvvvqvvmnndmepdsifrvrddantlhieplpyslee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.25179
    Matthews' coefficent 5.79 Rfactor 0.19285
    Waters 215 Solvent Content 78.59

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1nrk

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch