.
The Open Protein Structure Annotation Network
PDB Keyword
.

1no5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of HI0073 from Haemophilus influenzae, the nucleotide-binding domain of a two-protein nucleotidyl transferase. Proteins 60 807-811 2005
    Site S2F
    PDB Id 1no5 Target Id HI0073
    Molecular Characteristics
    Source
    Alias Ids TPS14859, Molecular Weight 13178.43 Da.
    Residues 114 Isoelectric Point 4.92
    Sequence mtsfaqldikseelaivktilqqlvpdytvwafgsrvkgkakkysdldlaiiseepldflardrlkeaf sesdlpwrvdlldwattsedfreiirkvyvviqekektvekptal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.282
    Matthews' coefficent 2.20 Rfactor 0.2003
    Waters 304 Solvent Content 54.39

    Ligand Information
    Ligands GOL (GLYCEROL) x 1;SO4 (SULFATE) x 2
    Metals NA (SODIUM) x 1;ZN (ZINC) x 8

    Jmol

     
    Google Scholar output for 1no5

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch