.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nnx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the hypothetical protein ygiW from E. coli. To be Published
    Site S2F
    PDB Id 1nnx Target Id ygiW
    Molecular Characteristics
    Source
    Alias Ids TPS14871, Molecular Weight 14010.04 Da.
    Residues 130 Isoelectric Point 5.08
    Sequence mkkfaaviavmalcsapvmaaeqggfsgpsatqsqaggfqgpngsvttvesakslrddtwvtlrgnive risddlyvfkdasgtinvdidhkrwngvtvtpkdtveiqgevdkdwnsveidvkqirkvnp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.251
    Matthews' coefficent 1.89 Rfactor 0.196
    Waters 125 Solvent Content 35.68

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1nnx

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch