The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Escherichia coli Protein ybgI, a toroidal structure with a dinuclear metal site. BMC Struct.Biol. 3 7 2003
    Site S2F
    PDB Id 1nmp Target Id ybgI
    Related PDB Ids 1nmo 
    Molecular Characteristics
    Alias Ids TPS14877, Molecular Weight 26891.05 Da.
    Residues 247 Isoelectric Point 5.07
    Sequence mknteleqlineklnsaaisdyapnglqvegketvqkivtgvtasqalldeavrlgadavivhhgyfwk gespvirgmkrnrlktllandinlygwhlpldahpelgnnaqlaallgitvmgeieplvpwgeltmpvp glelaswiearlgrkplwcgdtgpevvqrvawctgggqsfidsaarfgvdafitgevseqtihsareqg lhfyaaghhaterggiralsewlnentdldvtfidipnpa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.20 Rfree 0.253
    Matthews' coefficent 2.44 Rfactor 0.212
    Waters 576 Solvent Content 49.15

    Ligand Information
    Metals MG (MAGNESIUM) x 11


    Google Scholar output for 1nmp

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch