.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nij

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Escherichia coli YjiA protein suggests a GTP-dependent regulatory function. Proteins 54 371-374 2004
    Site S2F
    PDB Id 1nij Target Id yjiA
    Molecular Characteristics
    Source
    Alias Ids TPS14875, Molecular Weight 32015.65 Da.
    Residues 284 Isoelectric Point 4.58
    Sequence mienefgevsvddqligdratqiktltngciccsrsneledalldlldnldkgniqfdrlviectgmad pgpiiqtffshevlcqrylldgvialvdavhadeqmnqftiaqsqvgyadrilltktdvageaeklher larinarapvytvthgdidlgllfntngfmleenvvstkprfhfiadkqndissivveldypvdisevs rvmenlllesadkllrykgmlwidgepnrllfqgvqrlysadwdrpwgdekphstmvfigiqlpeeeir aafaglrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree
    Matthews' coefficent 2.00 Rfactor 0.223
    Waters 166 Solvent Content 38.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1nij

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch