.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mww

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the Hypothetical Protein HI1388.1 from Haemophilus influenzae. To be Published
    Site S2F
    PDB Id 1mww Target Id HI1388.1
    Molecular Characteristics
    Source
    Alias Ids TPS14868, Molecular Weight 14960.60 Da.
    Residues 128 Isoelectric Point 6.42
    Sequence mitvfglksklaprreklaeviynslhlgldipkgkhairflclekedfyypfdrsddytvieinlmag rmegtkkrlikmlfseleyklgirahdveitikeqpahcwgfrgmtgdeardldydiyv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.08 Rfree 0.269
    Matthews' coefficent 2.14 Rfactor 0.198
    Waters 356 Solvent Content 46.36

    Ligand Information
    Ligands GLU x 1
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 1mww

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch