The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Escherichia coli YcdX protein reveals a trinuclear zinc active site. PROTEINS: STRUCT.,FUNCT.,GENET. 51 315-318 2003
    Site S2F
    PDB Id 1m65 Target Id ycdX
    Molecular Characteristics
    Alias Ids TPS14878, Molecular Weight 26889.03 Da.
    Residues 245 Isoelectric Point 5.53
    Sequence mypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwprvvdgvgil rgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiatiasgnvhiishpgnpkye idvkavaeaaakhqvaleinnssflhsrkgsedncrevaaavrdaggwvalgsdshtaftmgefeeclk ildavdfpperilnvsprrllnflesrgmapiaefadl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.57 Rfree 0.20797
    Matthews' coefficent 2.56 Rfactor 0.177
    Waters 335 Solvent Content 51.89

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals ZN (ZINC) x 1;NA (SODIUM) x 3


    Google Scholar output for 1m65

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch