.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jov

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal 1.57-A Crystal Structure of HI1317. TO BE PUBLISHED
    Site S2F
    PDB Id 1jov Target Id HI1317
    Molecular Characteristics
    Source
    Alias Ids TPS14840, Molecular Weight 30799.60 Da.
    Residues 271 Isoelectric Point 6.75
    Sequence mkttllktltpelhlvqhndipvpslktcgwntknfpckghslsvgxpqnakqdvlwlsevepfkngna irggvpicypwfggvkqpahgtarirlwqlshyyisvhkvrlefelfsdlniieakvsmvftdkchltf thygeesaqaalhtyfnigdinqvevqglpetcfnslnqqqenvpsprhisenvdciysaenmqnqild ksfnrtialhhhnasqfvlwnpwhkktsgmsetgyqkmlcletarihhllefgeslsveislkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.57 Rfree 0.26
    Matthews' coefficent 2.19 Rfactor 0.208
    Waters 235 Solvent Content 43.40

    Ligand Information
    Ligands SO4 (SULFATE) x 1;TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 2
    Metals

    Jmol

     
    Google Scholar output for 1jov

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch