.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jop

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the bacterial YhcH protein indicates a role in sialic acid catabolism. J.Bacteriol. 187 5520-5527 2005
    Site S2F
    PDB Id 1jop Target Id HI0227
    Molecular Characteristics
    Source
    Alias Ids TPS14850, Molecular Weight 17669.43 Da.
    Residues 155 Isoelectric Point 5.08
    Sequence miissltnpnfkvglpkviaevcdylntldlnalengrhdindqiymnvmepetaepsskkaelhheyl dvqvlirgtenievgatypnlskyedyneaddyqlcadiddkftvtmkpkmfavfypyephkpccvvng ktekikklvvkvpvkli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.60 Rfree
    Matthews' coefficent 2.27 Rfactor 0.185
    Waters 78 Solvent Content 45.77

    Ligand Information
    Ligands
    Metals HG (MERCURY) x 12

    Jmol

     
    Google Scholar output for 1jop

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch