The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of HI1333 (YhbY), a putative RNA-binding protein from Haemophilus influenzae. Proteins 49 423-426 2002
    Site S2F
    PDB Id 1jo0 Target Id HI1333
    Molecular Characteristics
    Alias Ids TPS14858, Molecular Weight 10923.27 Da.
    Residues 99 Isoelectric Point 9.63
    Sequence mttlstkqkqflkglahhlnpvvmlggngltegvlaeienalnhhelikvkvagadretkqliinaivr etkaaqvqtighilvlyrpseeakiqlprk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.37 Rfree 0.2214
    Matthews' coefficent 1.77 Rfactor 0.1379
    Waters 264 Solvent Content 41.99

    Ligand Information
    Ligands GOL (GLYCEROL) x 7


    Google Scholar output for 1jo0

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch