.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jn1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of 2C-methyl-D-erythrol-2,4-cyclodiphosphate synthase from Haemophilus influenzae: activation by conformational transition. Proteins 49 135-138 2002
    Site S2F
    PDB Id 1jn1 Target Id HI0671
    Molecular Characteristics
    Source
    Alias Ids TPS14846, Molecular Weight 17192.75 Da.
    Residues 158 Isoelectric Point 5.63
    Sequence mirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdigklfpdtdmqy knadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaedlqcdieqvnvkatttekl gftgrqegiaceavallirq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.90 Rfree 0.2900000
    Matthews' coefficent 2.86 Rfactor 0.1980000
    Waters Solvent Content 57.02

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals CO (COBALT) x 4

    Jmol

     
    Google Scholar output for 1jn1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch