The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure and Functional Ligand Screening of HI0719, a Highly Conserved Protein from Bacteria to Humans in the YjgF/YER057c/UK114 Family. Biochemistry 42 80-89 2003
    Site S2F
    PDB Id 1j7h Target Id HI0719
    Molecular Characteristics
    Alias Ids TPS14842, Molecular Weight 14023.36 Da.
    Residues 130 Isoelectric Point 5.36
    Sequence mmtqiihtekapaaigpyvqavdlgnlvltsgqipvnpatgevpadivaqarqslenvkaiiekaglta adivkttvfvkdlndfaavnaeyerffkennhpnfparscvevarlpkdvgleieaiavrk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 3

    Ligand Information


    Google Scholar output for 1j7h

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch