.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j7g

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A Catalytic Mechanism for D-Tyr-tRNATyr Deacylase Based on the Crystal Structure of Hemophilus influenzae HI0670. J.Biol.Chem. 278 13496-13502 2003
    Site S2F
    PDB Id 1j7g Target Id HI0670
    Molecular Characteristics
    Source
    Alias Ids TPS14848, Molecular Weight 15861.40 Da.
    Residues 144 Isoelectric Point 5.53
    Sequence mialiqrvsqakvdvkgetigkigkgllvllgvekednrekadklaekvlnyrifsdendkmnlnvqqa qgellivsqftlaadtqkglrpsfskgaspalanelyeyfiqkcaeklpvstgqfaadmqvsltndgpv tfwlnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.64 Rfree 0.22
    Matthews' coefficent 3.12 Rfactor 0.194
    Waters 207 Solvent Content 60.55

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1j7g

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch