.
The Open Protein Structure Annotation Network
PDB Keyword
.

1in0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the YajQ protein from Haemophilus influenzae reveals a tandem of RNP-like domains. J.STRUCT.FUNCT.GENOM. 4 1-9 2003
    Site S2F
    PDB Id 1in0 Target Id HI1034
    Molecular Characteristics
    Source
    Alias Ids TPS14857, Molecular Weight 18550.21 Da.
    Residues 163 Isoelectric Point 5.87
    Sequence mpsfdivseitlhevrnavenanrvlstrydfrgveavielneknetikittesdfqleqlieiligsc ikrgiehssldipaesehhgklyskeiklkqgietemakkitklvkdskikvqtqiqgeqvrvtgksrd dlqaviqlvksaelgqpfqfnnfrd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.14 Rfree
    Matthews' coefficent 2.58 Rfactor 0.193
    Waters 355 Solvent Content 52.33

    Ligand Information
    Ligands MMC (METHYL) x 1
    Metals NA (SODIUM) x 2;HG (MERCURY) x 3

    Jmol

     
    Google Scholar output for 1in0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch