.
The Open Protein Structure Annotation Network
PDB Keyword
.

1imu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of HI0257, a bacterial ribosome binding protein. Biochemistry 40 10979-10986 2001
    Site S2F
    PDB Id 1imu Target Id HI0257
    Molecular Characteristics
    Source
    Alias Ids TPS14856, Molecular Weight 12190.20 Da.
    Residues 107 Isoelectric Point 6.29
    Sequence mtlnitskqmditpairehleerlaklgkwqtqlisphfvlnkvpngfsveasigtplgnllasatsdd mykaineveeklerqlnklqhksesrraderlkdsfen
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1imu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch