The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of an archaeal ribose-5-phosphate isomerase from Methanocaldococcus jannaschii (MJ1603). Acta Crystallogr.,Sect.F 65 1214-1217 2009
    Site RSGI
    PDB Id 3ixq Target Id mja001001603.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS13385, Molecular Weight 24828.56 Da.
    Residues 226 Isoelectric Point 4.89
    Sequence msnedlklkvakeavklvkdgmviglgtgstaalfirelgnrireeeltvfgiptsfeakmlamqyeip lvtldeydvdiafdgadeveettlflikggggchtqekivdynanefvvlvdesklvkklgekfpipve vipsayrvviralsemggeavirlgdrkrgpvitdngnmiidvfmniddaielekeinnipgvvengif tkvdkvlvgtkkgvktlkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.78 Rfree 0.188
    Matthews' coefficent 2.22 Rfactor 0.148
    Waters 889 Solvent Content 44.68

    Ligand Information
    Ligands PGO (S-1,2-PROPANEDIOL) x 11;ACT (ACETATE) x 1
    Metals CL (CHLORIDE) x 4


    Google Scholar output for 3ixq

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch