The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of H400V mutant TTHA0252 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 3ie2 Target Id ttk003001672.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14769, Molecular Weight 47014.66 Da.
    Residues 431 Isoelectric Point 6.11
    Sequence mrivpfgaarevtgsahlllaggrrvlldcgmfqgkeearnhapfgfdpkevdavllthahldhvgrlp klfregyrgpvyatratvllmeivledalkvmdepffgpedveealghlrpleygewlrlgalslafgq aghlpgsafvvaqgegrtlvysgdlgnrekdvlpdpslppladlvlaegtygdrphrpyretvreflei lektlsqggkvliptfaveraqeilyvlythghrlprapiyldspmagrvlslyprlvryfseevqahf lqgknpfrpaglevvehteaskalnrapgpmvvlagsgmlaggrilhhlkhglsdprnalvfvgyqpqg glgaeiiarppavrilgeevplrasvhtlggfsghagqdelldwlqgeprvvlvvgeeekllalgklla lrgqevslarfgegvpv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.275
    Matthews' coefficent 3.26 Rfactor 0.219
    Waters 78 Solvent Content 62.26

    Ligand Information
    Metals ZN (ZINC) x 4


    Google Scholar output for 3ie2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch