The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of H380A mutant TTHA0252 from Thermus thermophilus HB8 complexed with RNA. To be Published
    Site RSGI
    PDB Id 3ie1 Target Id ttk003001672.5
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14772, Molecular Weight 46986.60 Da.
    Residues 431 Isoelectric Point 6.11
    Sequence mrivpfgaarevtgsahlllaggrrvlldcgmfqgkeearnhapfgfdpkevdavllthahldhvgrlp klfregyrgpvyatratvllmeivledalkvmdepffgpedveealghlrpleygewlrlgalslafgq aghlpgsafvvaqgegrtlvysgdlgnrekdvlpdpslppladlvlaegtygdrphrpyretvreflei lektlsqggkvliptfaveraqeilyvlythghrlprapiyldspmagrvlslyprlvryfseevqahf lqgknpfrpaglevvehteaskalnrapgpmvvlagsgmlaggrilhhlkhglsdprnalvfvgyqpqg glgaeiiarppavrilgeevplrasvhtlggfsgaagqdelldwlqgeprvvlvhgeeekllalgklla lrgqevslarfgegvpv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.85 Rfree 0.291
    Matthews' coefficent 3.13 Rfactor 0.231
    Waters 38 Solvent Content 60.76

    Ligand Information
    Ligands __U-__U (SULFATE) x 1;SO4 (CITRATE) x 54;FLC x 2
    Metals ZN (ZINC) x 8


    Google Scholar output for 3ie1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch