The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Free and ATP-bound structures of Ap(4)A hydrolase from Aquifex aeolicus V5. Acta Crystallogr.,Sect.D 66 116-124 2010
    Site RSGI
    PDB Id 3i7v Target Id aae001000158.2
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12026, Molecular Weight 15755.67 Da.
    Residues 134 Isoelectric Point 9.16
    Sequence mkkefsaggvlfkdgevlliktpsnvwsfpkgniepgekpeetavrevweetgvkgeildyigeihywy tlkgerifktvkyylmkykegeprpswevkdakffpikeakkllkykgdkeifekalklkekfkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.251
    Matthews' coefficent 2.23 Rfactor 0.194
    Waters 345 Solvent Content 44.85

    Ligand Information


    Google Scholar output for 3i7v

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch