.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hjn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of thymidylate kinase in complex with dTDP and ADP from Thermotoga maritima. To be Published
    Site RSGI
    PDB Id 3hjn Target Id tma001001099.1
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS28460, Molecular Weight 22848.08 Da.
    Residues 197 Isoelectric Point 5.91
    Sequence mfitfegidgsgkstqiqllaqylekrgkkvilkrepggtetgekirkilleeevtpkaelflflasrn llvteikqylsegyavlldrytdssvayqgfgrnlgkeiveelndfatdglipdltfyidvdvetalkr kgelnrfekreflervregylvlarehperivvldgkrsieeihrdvvrevkrrwkldv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.285
    Matthews' coefficent 2.39 Rfactor 0.226
    Waters 52 Solvent Content 48.53

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 2;TYD (THYMIDINE-5'-DIPHOSPHATE) x 2
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3hjn

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch