The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Molecular Cloning and Crystal Structural Analysis of a Novel beta-N-Acetylhexosaminidase from Paenibacillus sp. TS12 Capable of Degrading Glycosphingolipids. J.Mol.Biol. 2009
    Site RSGI
    PDB Id 3gh7 Target Id my_001000188.3
    Molecular Characteristics
    Source Paenibacillus sp.
    Alias Ids TPS31859, Molecular Weight 55051.80 Da.
    Residues 502 Isoelectric Point 5.25
    Sequence mmsfipesasastsqpsilpkpvsytvgsgqfvltknasifvagnnvgetdelfnigqalakklnastg ytisvvksnqptagsiylttvggnaalgnegydlittsnqvtltankpegvfrgnqtllqllpagiekn tvvsgvqwviphsnisdkpeyeyrglmldvarhfftvdevkrqidlasqykinkfhmhlsddqgwriei kswpdlieigskgqvgggpggyytqeqfkdivsyaaeryievipeidmpghtnaalasygelnpdgkrk amrtdtavgystlmpraeityqfvedviselaaispspyihlggdesnatsaadydyffgrvtaiansy gkkvvgwdpsdtssgatsdsvlqnwtcsastgtaakakgmkvivspanayldmkyysdspiglqwrgfv ntnraynwdptdcikganiygvestlwtetfvtqdhldymlypkllsnaevgwtargdrnwddfkerli ehtprlqnkgikffadpiv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.18004
    Matthews' coefficent 2.29 Rfactor 0.13978
    Waters 562 Solvent Content 46.35

    Ligand Information


    Google Scholar output for 3gh7

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch