The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators. Nucleic Acids Res. 37 4723-4735 2009
    Site RSGI
    PDB Id 3gfj Target Id sto001001710.6
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS27336, Molecular Weight 16854.62 Da.
    Residues 146 Isoelectric Point 6.41
    Sequence mlesnenriqimstiakiyramsrelnrrlgelnlsyldflvlratsdgpktmaylanryfvtqsaita svdkleemglvvrvrdredrrkilieitekgletfnkgieiykklanevtgdlsedevilvldkiskil krieeisq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.245
    Matthews' coefficent 2.16 Rfactor 0.201
    Waters 125 Solvent Content 43.14

    Ligand Information
    Metals CA (CALCIUM) x 1


    Google Scholar output for 3gfj

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch