.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gfi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators. Nucleic Acids Res. 37 4723-4735 2009
    Site RSGI
    PDB Id 3gfi Target Id sto001001710.5
    Molecular Characteristics
    Source Sulfolobus tokodaii
    Alias Ids TPS27334, Molecular Weight 16854.62 Da.
    Residues 146 Isoelectric Point 6.41
    Sequence mlesnenriqimstiakiyramsrelnrrlgelnlsyldflvlratsdgpktmaylanryfvtqsaita svdkleemglvvrvrdredrrkilieitekgletfnkgieiykklanevtgdlsedevilvldkiskil krieeisq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.280
    Matthews' coefficent 2.54 Rfactor 0.234
    Waters 154 Solvent Content 51.61

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3gfi

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch