.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ecs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the alpha Subunit of Human Translation Initiation Factor 2B. J.Mol.Biol. 2009
    Site RSGI
    PDB Id 3ecs Target Id ar_001001325.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23796, Molecular Weight 33710.32 Da.
    Residues 305 Isoelectric Point 6.91
    Sequence mddkelieyfksqmkedpdmasavaairtlleflkrdkgetiqglranltsaietlcgvdssvavssgg elflrfislasleysdyskckkimiergelflrrislsrnkiadlchtfikdgatilthaysrvvlrvl eaavaakkrfsvyvtesqpdlsgkkmakalchlnvpvtvvldaavgyimekadlvivgaegvvenggii nkigtnqmavcakaqnkpfyvvaesfkfvrlfplnqqdvpdkfkykadtlkvaqtgqdlkeehpwvdyt apslitllftdlgvltpsavsdeliklyl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.65 Rfree 0.273
    Matthews' coefficent 2.71 Rfactor 0.214
    Waters 185 Solvent Content 54.64

    Ligand Information
    Ligands SO4 (SULFATE) x 10
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 3ecs

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch