.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dia

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site RSGI
    PDB Id 3dia Target Id aae001000761.1
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS12045, Molecular Weight 69640.56 Da.
    Residues 617 Isoelectric Point 8.26
    Sequence mawvvdefdvvviggghagieaalaaarmgaktamfvlnadtigqmscnpaiggiakgivvreidalgg emgkaidqtgiqfkmlntrkgkavqspraqadkkryreymkkvcenqenlyikqeevvdiivknnqvvg vrtnlgveyktkavvvttgtflngviyigdkmipggrlgeprseglsdfyrrfdfplirfktgtparld krtidfsalevapgddpppkfsfwtepvgsywfpkgkeqvncwityttpktheiirknlhrtalyggli kgigprycpsiedkivkfpdkerhqiflepegldtieiypnglstslpeevqwemyrsipglenvvlir payaieydvvpptelyptletkkirglfhagnfngttgyeeaagqgivaginaalrafgkepiylrrde syigvmiddlttkgvtepyrlftsrseyrlyirqdnailrlaklgrelgllseeqyklvkelereiekw kefykservsvavggdtrsysvatlmtmnytlddvkekfgyevpqhpyvkeeveiqlkyepyiererkl neklkkledtkippdidydkipgltkeareklkkfkpitvgqasridgitpaaitallvylgkld
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dia

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch