.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cq3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the DTDP-4-Keto-L-Rhamnose Reductase related protein (other form) from Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 3cq3 Target Id ttk003001362.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14705, Molecular Weight 11437.56 Da.
    Residues 103 Isoelectric Point 4.66
    Sequence mtarnpleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeavrqals rlpgveevevevtfeppwtlarlsekarrllgwg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.10 Rfree 0.22
    Matthews' coefficent 3.30 Rfactor 0.196
    Waters 388 Solvent Content 62.78

    Ligand Information
    Ligands GOL (GLYCEROL) x 11;P6G (HEXAETHYLENE) x 1;PG4 (TETRAETHYLENE) x 1
    Metals MG (MAGNESIUM) x 5

    Jmol

     
    Google Scholar output for 3cq3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch