.
The Open Protein Structure Annotation Network
PDB Keyword
.

3a1x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site RSGI
    PDB Id 3a1x Target Id mja001000026.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii
    Alias Ids TPS28458, Molecular Weight 31488.43 Da.
    Residues 274 Isoelectric Point 9.09
    Sequence mmivykgekmqfirvntlkinpevlkkrlenkgvvlektfldyafevkkspfsigstpeylfgyympqs issmippivlnpreddfildmcaapggktthlaqlmknkgtivaveisktrtkalksninrmgvlntii inadmrkykdyllkneiffdkilldapcsgniikdknrnvseedikycslrqkelidigidllkkdgel vystcsmeveeneevikyilqkrndveliiikanefkginikegyikgtlrvfppnepffiaklrki
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3a1x

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch