.
The Open Protein Structure Annotation Network
PDB Keyword
.

3a1p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Ribosome maturation protein RimM and Ribosomal protein S19. To be Published
    Site RSGI
    PDB Id 3a1p Target Id ttk003000856.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14457, Molecular Weight 10580.92 Da.
    Residues 93 Isoelectric Point 10.10
    Sequence mprslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvyitenmvgh klgefaptrtyrghgkeakatkkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.245
    Matthews' coefficent 2.20 Rfactor 0.197
    Waters 406 Solvent Content 42.80

    Ligand Information
    Ligands UNX (UNKNOWN) x 1
    Metals

    Jmol

     
    Google Scholar output for 3a1p

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch