The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of TTHA1623, a novel metallo-beta-lactamase superfamily protein from Thermus thermophilus HB8. Acta Crystallogr.,Sect.F 65 455-459 2009
    Site RSGI
    PDB Id 2zwr Target Id ttk003001371.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS31862, Molecular Weight 22298.49 Da.
    Residues 207 Isoelectric Point 5.14
    Sequence mrvfpvtlgplqenaylvetgegpvlidpgdepekllalfqttgliplaillthahfdhvgavaplvea ldlpvylhpldlplyegadlaarawglaipkpplpvrpleegmrlfgfqvlhlpghspghvafydpega qvfsgdllfrgsvgrydlpgadpkalfaslkrllslppetrvhpghgpgttlgleartnpfltglewea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.22896
    Matthews' coefficent 2.90 Rfactor 0.18773
    Waters 158 Solvent Content 57.60

    Ligand Information
    Metals ZN (ZINC) x 14


    Google Scholar output for 2zwr

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch