.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zue

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Modeling of tRNA-assisted mechanism of Arg activation based on a structure of Arg-tRNA synthetase, tRNA, and an ATP analog (ANP). Febs J. 276 4763-4779 2009
    Site RSGI
    PDB Id 2zue Target Id pho001001478.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS27328, Molecular Weight 72335.89 Da.
    Residues 629 Isoelectric Point 5.92
    Sequence mlmeiresvkerieeiikeiapqwegeielketpdpklgdfgtpiafklakllkrppieiaekiveklk lnlpegikdvkavngyinvfidyphfarilindilakgdrfgsseigkgkkvivehtsvnptkplhmgh arnailgdvmarilrflgyevevqnyiddlgiqfaqvywgylrlkeeferimnelrerglkdnpidhal gllyvevnrrlednpeleneirdimkklesgelygrklaeevvraqmvttyklgvkydllvwesdivrr klfeialellsknenfyipsdgkyrgafvmdlrklfpdmknpilvlrrsdgtatytgkdiayhlwkfgk idvdllykewdsttwttapdgksmpnkfgnanivinvigaeqkhpqlaikyalqllgfedaaanlyhla yehverpegkfsgrkgtwvgftvdeviqeavkrarelieeknpalsdeekaevaekvgigairynliky spdkkiifrwedvlnfegesapyiqyaharcssilrkaeeegikvdpetlfknadftklsererelvim lskfpriveqagkdvkphliawfanelaslfnkfymdhpvlkaeegvrearlllvmaveqvlknalylmgieaperm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.253
    Matthews' coefficent 2.48 Rfactor 0.213
    Waters 362 Solvent Content 50.43

    Ligand Information
    Ligands ANP (PHOSPHOAMINOPHOSPHONIC) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2zue

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch