The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TTHA1429, a novel metallo-beta-lactamase superfamily protein from Thermus thermophilus HB8. Proteins 73 1053-1057 2008
    Site RSGI
    PDB Id 2zo4 Target Id ttk003001899.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS28462, Molecular Weight 35445.57 Da.
    Residues 317 Isoelectric Point 6.15
    Sequence mkallpglyllpvpipyplktvnlyllqgagevalvdtalgtraargalelhlaelglcfqdvktillt hhhpdhyglsgffeglgarvflheeefarghrfwrepeafaeaswrlfldhgtpegalqgiretvektr ervhppqnplplrdgealevagkrlrvlwtpghadghaafyleeegvllagdallekvspnvglwaytr enplkdflrsldrladlgarvayaghfgpiadvrqraeelkahhqarleallalldgpktawelslhlf pqeldpagrrfafaetlahleylreegavgrggppyryfrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.25696
    Matthews' coefficent 2.14 Rfactor 0.19763
    Waters 281 Solvent Content 42.63

    Ligand Information
    Metals ZN (ZINC) x 2


    Google Scholar output for 2zo4

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch