The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site RSGI
    PDB Id 2zge Target Id ar_001000562.3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12192, Molecular Weight 134270.14 Da.
    Residues 1210 Isoelectric Point 6.26
    Sequence mrpsgtagaallallaalcpasraleekkvcqgtsnkltqlgtfedhflslqrmfnncevvlgnleity vqrnydlsflktiqevagyvlialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmr nlqeilhgavrfsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgscqkcdpscpngscwgageenc qkltkiicaqqcsgrcrgkspsdcchnqcaagctgpresdclvcrkfrdeatckdtcpplmlynpttyq mdvnpegkysfgatcvkkcprnyvvtdhgscvracgadsyemeedgvrkckkcegpcrkvcngigigef kdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldilktvkeitgflliqawpenr tdlhafenleiirgrtkqhgqfslavvslnitslglrslkeisdgdviisgnknlcyantinwkklfgt sgqktkiisnrgensckatgqvchalcspegcwgpeprdcvscrnvsrgrecvdkcnllegeprefven seciqchpeclpqamnitctgrgpdnciqcahyidgphcvktcpagvmgenntlvwkyadaghvchlch pnctygctgpglegcptngpkipsiatgmvgalllllvvalgiglfmrrrhivrkrtlrrllqerelve pltpsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankei ldeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqiakgmnyl edrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikwmalesilhriythqsdv wsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmidadsrpkfrelii efskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdadeylipqqgffsspstsrtpll sslsatsnnstvacidrnglqscpikedsflqryssdptgaltedsiddtflpvpeyinqsvpkrpags vqnpvyhnqplnpapsrdphyqdphstavgnpeylntvqptcvnstfdspahwaqkgshqisldnpdyq qdffpkeakpngifkgstaenaeylrvapqssefiga
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information


    Google Scholar output for 2zge

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch