.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zdj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of TTMA177, a Hypothetical Protein from Thermus thermophilus phage TMA. To be Published
    Site RSGI
    PDB Id 2zdj Target Id ar_001001060.1
    Molecular Characteristics
    Source Thermus thermophilus phage tma
    Alias Ids TPS12228, Molecular Weight 8079.73 Da.
    Residues 69 Isoelectric Point 4.46
    Sequence mkmrklvkdfgddytliqdsqevkaileyigseeephalfvkvgdgdyeevwgidsfvpynfleayrlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.263
    Matthews' coefficent 2.22 Rfactor 0.21
    Waters 109 Solvent Content 44.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2zdj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch