.
The Open Protein Structure Annotation Network
PDB Keyword
.

2zdb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TTHB099, a transcriptional regulator CRP family from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2zdb Target Id ttk003001007.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14506, Molecular Weight 22137.09 Da.
    Residues 195 Isoelectric Point 7.00
    Sequence mkrfarketiylrgeeartlyrleeglvrvvellpdgrlitlrhvlpgdyfgeealegkayrytaeamt eavvqglepramdhealhrvarnlarqmrrvqayeahlqtgelrariaryllfladtplsardrqgiyv tvsheeiadatasiresvskvladlrregliatayrrvylldlaalereagsaleaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.241
    Matthews' coefficent 3.02 Rfactor 0.208
    Waters 120 Solvent Content 59.33

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2zdb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch